DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and hdac9b

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_005158021.1 Gene:hdac9b / 393789 ZFINID:ZDB-GENE-040109-7 Length:609 Species:Danio rerio


Alignment Length:556 Identity:82/556 - (14%)
Similarity:161/556 - (28%) Gaps:215/556 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 MKPHRIRMTHNLLLNYGLY------------RKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPD 80
            ::.|:.::..:|.|...|:            ||:|:....:    |:.:...::.|..||     
Zfish   106 VRQHQAQIQEHLKLQQELHVMKQQQEQLEKERKLELQSQER----ELERHRREQQVLVLR----- 161

  Fly    81 NMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNKQASEICIN------------W 133
                 |::..|.:......|...|.||.             |:|...:|.:|            |
Zfish   162 -----NRERTRESAVASNEVKQKLQEFL-------------LSKSTKDITLNGIPQKITQSSKLW 208

  Fly   134 GGGLHHAKKSE-------ASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEAFYTTDRV 191
            ....||....:       ||..|.::                                       
Zfish   209 YTASHHTSLEQSSPPLGGASSSCKIS--------------------------------------- 234

  Fly   192 MTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFVPIISK----VMETFQP 252
                       .|...|.||....:......|:.:|..:.....|....|::.:    :|..|:.
Zfish   235 -----------LPSPQDYRDDFPLRKTVSEPNLKVRSRLKQKVAERRSSPLLRRKEGNIMTPFKK 288

  Fly   253 AAVVL----------------QCGADSLTGDRLGCFNLTVK-------------GHGKCVEFVKK 288
            .|:.|                ..||.|..|...|..:|.|.             |....|..:..
Zfish   289 RALELLESTASSSAPGSGPSSPNGACSALGAENGPSSLPVTTRTERWPSQSRLLGPESSVSMLNL 353

  Fly   289 YNLPFLMVGGGGYTIRNVSRCWTYET---SVALAVE-----------IANELPYNDYFEYFGPDF 339
            |..|         ::.|:|..::..:   |.||.::           :...||    .:..|| .
Zfish   354 YTSP---------SLPNISLGFSAASSPISAALGLQEKHVDNGAVSAVIQGLP----TQLLGP-V 404

  Fly   340 KLHISPSNMTNQNTSEYLEKIKNRLFENLRML--------PHAPGVQIQAIPEDAINDESDDEDK 396
            .|.:..:.:::.:.:.....::.....:.::|        |.:|...::       |..|....|
Zfish   405 PLSVMETKVSSSHQALLQHLLQKEQLRHQKILSSGQSPVHPPSPLAMME-------NSPSSTRPK 462

  Fly   397 VDK--------DDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRSYKGQRKRPRLDKDTNSNKA 453
            :.:        ...||||...:.::.:...|..|                 |:.:..:..:.||.
Zfish   463 LPRHRPLNRTQSAPLPQSTLAQLVIQQQHQSFLE-----------------KQKQYQQQVHINKM 510

  Fly   454 SSETSSEIK------DEKEKGDGADGEESTASNTNS 483
            .|::..:::      .|.|:.:|.|.:|......:|
Zfish   511 LSKSIEQLRQPNVHLQESEEEEGEDCQEHAMQEESS 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 61/429 (14%)
hdac9bXP_005158021.1 ClassIIa_HDAC9_Gln-rich-N 68..157 CDD:197399 8/54 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.