DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and Hdac8

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_017457598.1 Gene:Hdac8 / 363481 RGDID:1562895 Length:393 Species:Rattus norvegicus


Alignment Length:299 Identity:135/299 - (45%)
Similarity:204/299 - (68%) Gaps:2/299 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNV 94
            |.|..|.|:|:..|.|:::|.|.:|..|:.:||..||:|.|::.|:.:..:...::...:: :.:
  Rat    35 PKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDEDHPDSIE-YGL 98

  Fly    95 GEDCPVFDGLYEFCQLSAGGSVAAAVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGIL 159
            |.|||..:|::::.....||::.||..|.....::.|||.||.|||||.|||||||:||.|||||
  Rat    99 GYDCPATEGIFDYAAAIGGGTITAAQCLIDGKCKVAINWSGGWHHAKKDEASGFCYLNDAVLGIL 163

  Fly   160 ELLKYHQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGE-YFPGTGDLRDIGAGKGKYYAVN 223
            .|.:...|:||:|:|:|||||||:||..|.:|||||.||:.. :||||||:.|:|.|||:||:||
  Rat   164 RLRRKFDRILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDMSDVGLGKGRYYSVN 228

  Fly   224 IPLRDGMDDDAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKK 288
            :|::||:.|:.|..|...::.:|.:.|.|.|||||.|||::.||.:..||:|..|.|||:::|.:
  Rat   229 VPIQDGIQDEKYYHICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYVLQ 293

  Fly   289 YNLPFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELP 327
            :.|..|::|||||.:.|.:|||||.|.|.|...:::|:|
  Rat   294 WQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 135/299 (45%)
Hdac8XP_017457598.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54588
OrthoDB 1 1.010 - - D732770at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.