DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and Hdac10

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_006242280.1 Gene:Hdac10 / 362981 RGDID:1305874 Length:666 Species:Rattus norvegicus


Alignment Length:315 Identity:78/315 - (24%)
Similarity:143/315 - (45%) Gaps:52/315 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFL---RSIRPDNMSEYNKQMQR 91
            |.|:....:.|...||..:.:.....:|:.:|:...||.||:..:   :::..:.:...:||   
  Rat    28 PERLTAALDGLRQRGLEERCQCLSVCEASEEELGLVHSPEYIALVQKTQTLDKEELHTLSKQ--- 89

  Fly    92 FNVGEDCPVFDGLY------EFCQLSAGGSVAAAVKLNKQASEICINWGGGL-----HHAKKSEA 145
                     :|.:|      ...:|:||    ||::|........::.|..|     ||::::.|
  Rat    90 ---------YDAVYFHPDTFHCARLAAG----AALRLVDAVLTGAVHNGVALVRPPGHHSQRAAA 141

  Fly   146 SGFCYVNDIVLGILELLKYH--QRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKY--GEYFP-- 204
            :|||..|::.:......:.:  ||:|.:|.|||||.|::..|.....|:..|:|:|  |.::|  
  Rat   142 NGFCVFNNVAIAARHAKQKYGLQRILIVDWDVHHGQGIQYIFEDDPSVLYFSWHRYEHGNFWPFL 206

  Fly   205 GTGDLRDIGAGKGKYYAVNIPLRD-GMDDDAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDR 268
            ...|...:|.|:|:.:.||:|... ||.:..|.:.|:.::..:...|.|..|::..|.||..||.
  Rat   207 PESDADTVGRGRGQGFTVNLPWNQVGMGNADYLAAFLHVLLPLAFEFDPELVLVSAGFDSAIGDP 271

  Fly   269 LGCFNLTVKGHGKCVEFVKKYNLPFLMVGG-------GGYTIRNVSR--CWTYET 314
            .|....|    .:|  |.....|..::.||       |||.:.::::  |...:|
  Rat   272 EGQMQAT----PEC--FAHLTQLLQVLAGGRICAVLEGGYHLESLAQSVCMMVQT 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 78/315 (25%)
Hdac10XP_006242280.1 Arginase_HDAC 18..354 CDD:302587 78/315 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.