DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and Hdac11

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001100080.2 Gene:Hdac11 / 297453 RGDID:1311706 Length:347 Species:Rattus norvegicus


Alignment Length:234 Identity:69/234 - (29%)
Similarity:96/234 - (41%) Gaps:39/234 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GGSVAAAVKLNKQASE--ICINWGGGLHHAKKSEASGFCYVNDIVLGI---LELLKYHQRVLYID 172
            ||::.|    .|.|.|  ..||.|||.||.......|||...||.|.|   .|.::...|...||
  Rat   119 GGTIMA----GKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIID 179

  Fly   173 IDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYES 237
            :|.|.|:|.|..|....||..:..:. ...:||....::....|       :.|..|.:|:.|..
  Rat   180 LDAHQGNGHERDFMGDKRVYIMDVYN-RHIYPGDRFAKEAIRRK-------VELEWGTEDEEYLE 236

  Fly   238 IFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVE----FVKKYNLPFLMVGG 298
            .....:.:.::...|..||...|.|.|.|||||..:::..|..|..|    .|:.:::|.|||..
  Rat   237 KVERNVRRSLQEHLPDVVVYNAGTDVLEGDRLGGLSISPAGIVKRDEVVFRVVRAHDIPILMVTS 301

  Fly   299 GGYTIRNVSRCWTYETSVALAVEIAN---------ELPY 328
            |||..|         |:..:|..|.|         |.||
  Rat   302 GGYQKR---------TARIIADSILNLHDLGLIGPEFPY 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 69/234 (29%)
Hdac11NP_001100080.2 HDAC_classIV 35..319 CDD:212519 65/220 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.