DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and F43G6.17

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001263677.1 Gene:F43G6.17 / 24104581 WormBaseID:WBGene00219378 Length:281 Species:Caenorhabditis elegans


Alignment Length:210 Identity:52/210 - (24%)
Similarity:81/210 - (38%) Gaps:53/210 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 YESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVK----GHGKCVEFVKKYNL---- 291
            |.|:|..::..::|.|||..:::..|.||...|.:..|...||    ||..|:     .|.    
 Worm     7 YVSVFHHVLLTMLEQFQPELILISAGFDSGYYDVMMEFGQGVKANGYGHMACL-----LNQICPG 66

  Fly   292 PFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGP--DFKLHISPS------NM 348
            ..|.:..|||      ..:.|..|.::.|.....||.        |  |....||.:      |:
 Worm    67 KILAILEGGY------HPYNYTESASMMVRGLLNLPI--------PRLDIPERISGALLETTWNI 117

  Fly   349 TNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQAIPEDAINDESDDEDKVDK--DDRLPQSDKDKR 411
            .|.::..|     .:|.|.|::|.|..  :...:|:.|.:......:|:.|  ||.     |..|
 Worm   118 LNHHSEWY-----PKLGERLKLLEHQQ--KELGLPQFAFDQTMFLGEKMRKMYDDM-----KKHR 170

  Fly   412 IVPENEY----SDSE 422
            ||...|:    ||.:
 Worm   171 IVRTREWFPEMSDDQ 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 37/152 (24%)
F43G6.17NP_001263677.1 Arginase_HDAC <1..125 CDD:388375 33/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162758
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.