DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and hda-11

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_505699.3 Gene:hda-11 / 183226 WormBaseID:WBGene00007953 Length:334 Species:Caenorhabditis elegans


Alignment Length:315 Identity:75/315 - (23%)
Similarity:123/315 - (39%) Gaps:39/315 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEY 70
            ::.:.|:.:.::..:.....||....:.|.....|....|.....:..|:..|.:|:|:.|..:|
 Worm    16 QRPIVYHSEYNVTAFGIEHLHPFDSSKWRRVITHLKEMNLITDETLVEPNLPTFEELTRVHDRKY 80

  Fly    71 VRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNKQASEICINWGG 135
               |:|:|....:....::........|.:...|....:|.|||:|.||....|..  ..||.||
 Worm    81 ---LKSVRNPIKAAQIVEIPFVGCLPPCIIESKLLHPLRLQAGGTVLAANLALKHG--WAINVGG 140

  Fly   136 GLHHAKKSEASGFCYVNDIVLGILELL--KYHQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHK 198
            |.|||..|...|||:..||.:.|.:|.  |.....:.:|:|.|.|:|....|.....|..  |..
 Worm   141 GFHHASHSGGGGFCFYADITMAIFDLFDKKAIANAIVVDLDAHQGNGHARDFADNPNVFV--FDV 203

  Fly   199 YGEY-FPGTGDLRDIGAGKGKYYAVN--IPLRDGMDDDAYESIFVPIISKVM----ETFQPA--A 254
            :..| :|...:.|..         :|  :.:.....|.:|.|.....:::.:    :|..|.  .
 Worm   204 FNPYVYPHDREARQF---------INRAVHVNGHTTDTSYLSELRKQLAQCLIDREKTTPPGFDF 259

  Fly   255 VVLQCGADSLTGDRLGCFNLTVKGHGKCV--------EFVKKYNLPFLMVGGGGY 301
            ::...|.|.|.||.||...|:    .:|:        ...|...:|..||..|||
 Worm   260 IMFNAGTDCLLGDPLGAMKLS----PQCIIARDEVVFNLAKSKGIPICMVTSGGY 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 75/315 (24%)
hda-11NP_505699.3 HDAC_classIV 36..325 CDD:212519 74/295 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.