DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and hda-4

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001257278.1 Gene:hda-4 / 181723 WormBaseID:WBGene00001837 Length:869 Species:Caenorhabditis elegans


Alignment Length:304 Identity:81/304 - (26%)
Similarity:147/304 - (48%) Gaps:34/304 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPD---NMSEYNKQMQRF- 92
            ||:...:.|:.:|..:|.|.....||:.:::...||..|..|. ::.|.   .:...:..::|| 
 Worm   489 RIQSIWSKLIEHGHVQKCEKVTAKKASLEQLQLVHSQTYTTFF-AVSPTACLKIDANSLPLKRFL 552

  Fly    93 -----NVGEDCPVF--DGLYEFCQLSAGGSVAAAVKLNKQASE-------ICINWGGGLHHAKKS 143
                 .:|.|...:  |...:.....|.|::   ::|:.|.:|       .||...|  |||:..
 Worm   553 QLPCGGIGVDSDTYFNDASTQTAARLAAGTL---IELSSQVAEGRLKNGFACIRPPG--HHAEHE 612

  Fly   144 EASGFCYVNDIVLGILEL-LKYH---QRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKY--GEY 202
            :|.|||:.|::.:.:..| .||.   .::..||.|||||:|.:.:|.....|:.:|.|::  |.:
 Worm   613 QAMGFCFFNNVAVAVKVLQTKYPAQCAKIAIIDWDVHHGNGTQLSFENDPNVLYMSLHRHDKGNF 677

  Fly   203 FPGTGDLRDIGAGKGKYYAVNIPLR-DGMDDDAYESIFVPIISKVMETFQPAAVVLQCGADSLTG 266
            |||||.:.::|....|...||:|.. |.|.|..|.:.:..:|..||.:|.|..:::..|.|:..|
 Worm   678 FPGTGSVTEVGKNDAKGLTVNVPFSGDVMRDPEYLAAWRTVIEPVMASFCPDFIIVSAGFDACHG 742

  Fly   267 --DRLGCFNLTVKGHGKCVEFVKKY-NLPFLMVGGGGYTIRNVS 307
              :.||.:.:|.:..|...:.:..| :...::...|||.::::|
 Worm   743 HPNALGGYEVTPEMFGYMTKSLLNYASGKVVLALEGGYDLKSIS 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 81/304 (27%)
hda-4NP_001257278.1 HDAC_classIIa 460..834 CDD:212544 81/304 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.