DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and hdac6

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_031746852.1 Gene:hdac6 / 100379853 XenbaseID:XB-GENE-5873935 Length:1056 Species:Xenopus tropicalis


Alignment Length:497 Identity:116/497 - (23%)
Similarity:189/497 - (38%) Gaps:121/497 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YDSDIGN--YYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLR 75
            ||..:..  . :.:..|..|.||....:.:..|||..:....:..:|:.:|::..||.:||..:.
 Frog    94 YDEQMAQTCCXWDENFPECPARIWAVRDKMAEYGLAERCVAVQAREASEEEISLIHSPQYVALMG 158

  Fly    76 SIRPDNMSEYNKQMQRFNVGEDCPVFDGLY----EF-CQLSAGGSVAAAVK--LNKQASEICINW 133
            |.:..|:.|......|         :|.:|    .| |...|.|||...|.  |.::..      
 Frog   159 STQNMNVEELQALSDR---------YDSVYLHPTSFTCASLAVGSVLQLVDKVLRREIR------ 208

  Fly   134 GGGL-------HHAKKSEASGFCYVNDIVLGILELLKYHQ------RVLYIDIDVHHGDGVEEAF 185
             .||       |||...:.:|:|..|.:.:.    .:|.|      |||.:|.|||||.|.:..|
 Frog   209 -NGLAVVRPPGHHAHVDQMNGYCMFNQLAIA----ARYAQRTYGAKRVLIVDWDVHHGQGTQFLF 268

  Fly   186 YTTDRVMTVSFHKY--GEYFPGTGDLRD-----IGAGKGKYYAVNIPL-RDGMDDDAYESIFVPI 242
            .....|:..|.|:|  |.::|   .||:     :|..:|:.:.||:.. :..|.|..|..:|:.|
 Frog   269 ENDPSVLYFSVHRYENGGFWP---HLRESASSAVGKERGERFNVNVAWNKTRMSDADYIHVFLNI 330

  Fly   243 ISKVMETFQPAAVVLQCGADSLTGD-------RLGCFN-----LTVKGHGKCVEFVKKYNLPFLM 295
            :..:...|||..|::..|.||:.||       ..|||:     |.....|:.:..::        
 Frog   331 LLPIAYEFQPHLVLVAAGFDSVVGDPKGEMSATPGCFSHLTHLLMSLAQGRLILSLE-------- 387

  Fly   296 VGGGGYTIRNVSR--CWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLE 358
               |||..|:::.  |...:   ||..:...:||             |..:|....       |:
 Frog   388 ---GGYNQRSLAEGVCACLK---ALLGDPCPKLP-------------LPSAPCQSA-------LD 426

  Fly   359 KIKNRLFENLRMLP-----HAPGVQIQAIPEDAINDESDDEDKVDKDDRLPQSDKD-KRIVPENE 417
            .|.:.|..:.|:..     .:.|..|.. |:.|.....|..|:...:..|.||..: .|.||...
 Frog   427 SISDTLSAHCRLWKVLQDYESEGEAIDE-PQSAEEQPPDGADEPPLEKVLEQSMMEVMREVPAQR 490

  Fly   418 YSDSEDE-------------GEGGRRDNRSYKGQRKRPRLDK 446
            .:...||             .|..:|.|:.:|..:....||:
 Frog   491 TALVYDEQMMEHHNMWDSCHPESPQRINQIFKRHKDLGLLDR 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 96/402 (24%)
hdac6XP_031746852.1 Arginase_HDAC 103..439 CDD:418394 94/392 (24%)
Arginase_HDAC 495..848 CDD:418394 8/38 (21%)
zf-UBP 978..1033 CDD:396634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.