DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and HDAC5

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_016879477.1 Gene:HDAC5 / 10014 HGNCID:14068 Length:1161 Species:Homo sapiens


Alignment Length:342 Identity:94/342 - (27%)
Similarity:148/342 - (43%) Gaps:63/342 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPDNMSEYNKQMQ 90
            ||....||:...:.|...||..|.|..|..|||.||:...|| ||...|....|.|..:.:.:..
Human   743 HPEHAGRIQSIWSRLQETGLLSKCERIRGRKATLDEIQTVHS-EYHTLLYGTSPLNRQKLDSKKL 806

  Fly    91 RFNVGEDCPVFDGLYEFCQLSAGG-SVAAAVKLNKQASEICINWGGGL----------------- 137
               :|   |:...:|  ..|..|| .|.:....|:..|...:....|.                 
Human   807 ---LG---PISQKMY--AVLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGF 863

  Fly   138 -------HHAKKSEASGFCYVNDIVLGILELLKYH---QRVLYIDIDVHHGDGVEEAFYTTDRVM 192
                   |||::|.|.|||:.|.:.: ..:||:..   .:||.:|.|:|||:|.::|||....|:
Human   864 AIIRPPGHHAEESTAMGFCFFNSVAI-TAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVL 927

  Fly   193 TVSFHKY--GEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMD----DDAYESIFVPIISKVMETFQ 251
            .:|.|:|  |.:|||:|...::|.|.|..|.||:....|:|    |..|.:.|..::..:...|.
Human   928 YISLHRYDNGNFFPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFS 992

  Fly   252 PAAVVLQCGADSLTG--DRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGG-------GGYTIRNVS 307
            |..|::..|.|::.|  ..||.:::|.:..|.....:      ..:.||       ||:.:..: 
Human   993 PDVVLVSAGFDAVEGHLSPLGGYSVTARCFGHLTRQL------MTLAGGRVVLALEGGHDLTAI- 1050

  Fly   308 RCWTYETSVA--LAVEI 322
             |...|..|:  |:||:
Human  1051 -CDASEACVSALLSVEL 1066

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 94/342 (27%)
HDAC5XP_016879477.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.