DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and STOML1

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_004800.2 Gene:STOML1 / 9399 HGNCID:14560 Length:398 Species:Homo sapiens


Alignment Length:359 Identity:100/359 - (27%)
Similarity:157/359 - (43%) Gaps:80/359 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 DTQAKHSHGFLYS----------------DEEISDKASTCGKLLIFLSVALVIMTLPFSLFVCFK 211
            |...:.|.|||.|                |...|..:..|..|:.||...|:::|.|.|.:...|
Human    16 DRFQQSSFGFLGSQKGCLSPERGGVGTGADVPQSWPSCLCHGLISFLGFLLLLVTFPISGWFALK 80

  Fly   212 VVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDA 276
            :|..|||.::|||||:..  .:|||:..:||.|||:.|||||||.::|||.::.:||...:||.|
Human    81 IVPTYERMIVFRLGRIRT--PQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGA 143

  Fly   277 VVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAW 341
            .|.:|:.:..:|:..|::.:.:||:.||..:...:..|.|.||..|::.||..:.:::::.|.||
Human   144 DVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKISDQLLLEINDVTRAW 208

  Fly   342 GIKVERVE--IKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAA- 403
            |::|:|||  ::.|..|.|                                        ||||. 
Human   209 GLEVDRVELAVEAVLQPPQ----------------------------------------DSPAGP 233

  Fly   404 --------LQLRYL-QTLNTISAEKNSTIVFPLPIDLITYFLKTNEATTQQNARA------AAAA 453
                    |.|.:| .::|:::....|    |.|.|.:....:......|..||:      |...
Human   234 NLDSTLQQLALHFLGGSMNSMAGGAPS----PGPADTVEMVSEVEPPAPQVGARSSPKQPLAEGL 294

  Fly   454 IGNTPPPLQLAPQQQMGQQQQPQYQQPQQQQQQY 487
            :....|.|..|...|:|...|.....|...|..|
Human   295 LTALQPFLSEALVSQVGACYQFNVVLPSGTQSAY 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 78/263 (30%)
SPFH_stomatin 229..430 CDD:259801 60/212 (28%)
STOML1NP_004800.2 Tyrosine-type lysosomal sorting signal. /evidence=ECO:0000255, ECO:0000269|PubMed:19696025 6..10
PHB 77..217 CDD:214581 55/141 (39%)
SPFH_SLP-1 94..224 CDD:259814 49/131 (37%)
SCP2 304..395 CDD:280250 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.