DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and PHB2

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_011747.2 Gene:PHB2 / 853146 SGDID:S000003463 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:252 Identity:53/252 - (21%)
Similarity:98/252 - (38%) Gaps:37/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 GKLLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVD 251
            |.||:....||.|....|:       |....||:::.....:.......|..||.|.:|:....|
Yeast    42 GGLLLLGGGALFINNALFN-------VDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYD 99

  Fly   252 LRTRTYDVPPQEVL----TKDSVTVSVDAVVYYRVSNATV-SIANVENAHHSTRLL---AQTTLR 308
            :|.:     |:.|.    |||...|::...|..|.....: :|.......:..|:|   ....|:
Yeast   100 VRAK-----PRNVASLTGTKDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLK 159

  Fly   309 NTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQL-------------- 359
            ..:...:..:::::|..:|..::..|......:.|.::.|.|..:....:.              
Yeast   160 AVVAQFNASQLITQREKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDA 224

  Fly   360 QRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTIS 416
            |||.....:|.:|.:..|:.|:||.|::..:.||   |..|...::|:.|.|...|:
Yeast   225 QRAAFVVDKARQEKQGMVVRAQGEAKSAELIGEA---IKKSRDYVELKRLDTARDIA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 52/251 (21%)
SPFH_stomatin 229..430 CDD:259801 43/210 (20%)
PHB2NP_011747.2 SPFH_prohibitin 58..252 CDD:259799 39/205 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.