DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and AT5G51570

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_199970.1 Gene:AT5G51570 / 835231 AraportID:AT5G51570 Length:292 Species:Arabidopsis thaliana


Alignment Length:255 Identity:55/255 - (21%)
Similarity:100/255 - (39%) Gaps:44/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 VQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQ-EVLTKDSVTVSVDA 276
            :::....|:.|.||...  ...||..|..|....:....|.||...:..: |..|||:|.|.:..
plant    12 IEQASVGVVERWGRFEH--IAEPGCHFFNPLAGQWLAGVLSTRIKSLDVKIETKTKDNVFVQLVC 74

  Fly   277 VVYYRVSNATVSIA--NVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATD 339
            .:.|||..|:...|  .::|.....:......:|..:....|..:..::..::.::..:|::...
plant    75 SIQYRVVKASADDAFYELQNPKEQIQAYVFDVVRALVPMMTLDALFEQKGEVAKSVLEELEKVMG 139

  Fly   340 AWGIKVERVEIKDVRLP----------------VQLQRAMAAEAE-------AAREARAKVIAAE 381
            |:|..:|.:.:.|: :|                :||......|||       |..||.||.:...
plant   140 AYGYSIEHILMVDI-IPDPSVRKAMNEINAAQRLQLASVYKGEAEKILQVKRAEAEAEAKYLGGV 203

  Fly   382 G----EQKASRALRE-----ASEVIGDSPAALQ-----LRYLQTLNTI-SAEKNSTIVFP 426
            |    .|..:..|||     :.:|.|.|...:.     .:|..|:..: ::.||:|:..|
plant   204 GVARQRQAITDGLRENILNFSDKVEGTSAKEVMDLIMITQYFDTIRDLGNSSKNTTVFLP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 55/255 (22%)
SPFH_stomatin 229..430 CDD:259801 51/239 (21%)
AT5G51570NP_199970.1 SPFH_like_u4 11..280 CDD:259805 55/255 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.