DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and HIR2

DIOPT Version :10

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_566135.1 Gene:HIR2 / 821309 AraportID:AT3G01290 Length:285 Species:Arabidopsis thaliana


Alignment Length:161 Identity:34/161 - (21%)
Similarity:57/161 - (35%) Gaps:41/161 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YSSAASSPTVSLNPSGRL----------QQTLAGSV------------EVKGKSLHSG------K 57
            |..:.|.|...|.|.|.|          .|.:..|:            |.|||....|      |
plant  1475 YRLSQSIPFTPLPPKGELFTVYRLEESSPQIMNNSMSSWSHHGFYAKFEFKGKEEMGGGLRRASK 1539

  Fly    58 FSTVKLNPEIAGAGRFFEFRSRFIPASI----EFAQESPLCTTLLKDELKIRTVEHLLSALEAKG 118
            .:.......|..:|.|:..:| |:|..:    ...:|..:....|::..:.|..:.||.|..   
plant  1540 VACTWSENYILKSGHFYIIKS-FLPEVVNTWSSIYKEDTVLQLCLREIQQQRAAQKLLFAFN--- 1600

  Fly   119 VDNCRIQIESESSDDREVEV-PIFDGSAKEW 148
                :::.:|.....|.:|| .::..||.:|
plant  1601 ----QMKPKSIPYSPRFLEVFLMYCHSAGQW 1627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 SPFH_stomatin 229..430 CDD:259801
HIR2NP_566135.1 SPFH_like_u4 10..278 CDD:259805
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.