Sequence 1: | NP_001246627.1 | Gene: | CG42540 / 38562 | FlyBaseID: | FBgn0260657 | Length: | 517 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081218.3 | Gene: | Stoml1 / 69106 | MGIID: | 1916356 | Length: | 399 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 69/204 - (33%) |
---|---|---|---|
Similarity: | 114/204 - (55%) | Gaps: | 18/204 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 163 DTQAKHSHGFLYS----------------DEEISDKASTCGKLLIFLSVALVIMTLPFSLFVCFK 211
Fly 212 VVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDA 276
Fly 277 VVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAW 341
Fly 342 GIKVERVEI 350 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42540 | NP_001246627.1 | HflC | 188..440 | CDD:223407 | 60/163 (37%) |
SPFH_stomatin | 229..430 | CDD:259801 | 44/122 (36%) | ||
Stoml1 | NP_081218.3 | Tyrosine-type lysosomal sorting signal. /evidence=ECO:0000250|UniProtKB:Q9UBI4, ECO:0000255 | 6..10 | ||
PHB | 77..217 | CDD:214581 | 53/141 (38%) | ||
SPFH_SLP-1 | 94..224 | CDD:259814 | 46/126 (37%) | ||
SCP2 | 305..396 | CDD:280250 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0330 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1062075at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |