DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and Phb1

DIOPT Version :10

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_476607.2 Gene:Phb1 / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster


Alignment Length:224 Identity:50/224 - (22%)
Similarity:101/224 - (45%) Gaps:25/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 VQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLT--KDSVTVSVD 275
            |:...|||||.....::....|.|..|.:|.:......|:|::..:||   |:|  ||...|::.
  Fly    30 VEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNVP---VITGSKDLQNVNIT 91

  Fly   276 AVVYYR-VSNATVSIANVENAHHSTRLL---AQTTLRNTMGTRHLHEILSERMTISGTMQVQLDE 336
            ..:.|| :.:....|..:....:..|:|   |...|:..:......|::::|..:|..:..:|..
  Fly    92 LRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTV 156

  Fly   337 ATDAWGIKVERVEI------KDVRLPVQLQRAMAAEAEAAR--------EARAKVIAAEGEQKAS 387
            ....:|..::.:.:      ::..|.|::::....|||.||        :..|.:|:|||:.:|:
  Fly   157 RAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAA 221

  Fly   388 RALREASEVIGDSPAALQLRYLQTLNTIS 416
            ..|.::....||  ..::||.::....|:
  Fly   222 GLLAKSFGEAGD--GLVELRRIEAAEDIA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 SPFH_stomatin 229..430 CDD:259801 44/208 (21%)
Phb1NP_476607.2 SPFH_prohibitin 27..221 CDD:259799 43/193 (22%)

Return to query results.
Submit another query.