DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and Phb2

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster


Alignment Length:278 Identity:57/278 - (20%)
Similarity:122/278 - (43%) Gaps:41/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 SDEEISDKASTCGK-----LLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIF-RLGRLMQGGAK 233
            :..:::|.|...||     |.|.|.|...:....:.:......|:...||:|| |||.: |....
  Fly     2 AQSKLNDLAGKLGKGGPPGLGIGLKVLAAVGAAAYGVSQSLYTVEGGHRAIIFSRLGGI-QSDIY 65

  Fly   234 GPGIFFILPCIDSYARVDLRTRTYDVPPQEVL----TKDSVTVSVDAVVYYRVSNATVSIANVE- 293
            ..|:...:|........|:|:|     |:::.    :||...:::...|..|..:..:...:.: 
  Fly    66 SEGLHVRIPWFQYPIIYDIRSR-----PRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQL 125

  Fly   294 NAHHSTRLL---AQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEI----- 350
            ...:..::|   ....|::.:...:..:::::|..:|..::.:|.|....:.|.::.|.:     
  Fly   126 GVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSF 190

  Fly   351 -KDVRLPVQLQRAMAAEAE--------AAREARAKVIAAEGEQKASRALREASEVIGDSPAALQL 406
             |:....::.::....||:        |.:|.:.|::.||||.:|::.|..|   :..:||.|:|
  Fly   191 GKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLA---VKQNPAYLKL 252

  Fly   407 RYLQT----LNTISAEKN 420
            |.|:.    ..||::.:|
  Fly   253 RKLRAAQSIARTIASSQN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 54/265 (20%)
SPFH_stomatin 229..430 CDD:259801 41/218 (19%)
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 37/199 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.