DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and phb2b

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001002681.2 Gene:phb2b / 436954 ZFINID:ZDB-GENE-040718-430 Length:303 Species:Danio rerio


Alignment Length:235 Identity:54/235 - (22%)
Similarity:105/235 - (44%) Gaps:35/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 VQEYERAVIF-RLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEV--LT--KDSVTV 272
            |:..:||:|| |:|.:........|:.|.:|........|:|.|     |:::  ||  ||...|
Zfish    51 VEGGQRAIIFNRIGGVQLDTVLTEGLHFRIPWFQYPIIYDIRAR-----PRKISSLTGSKDLQMV 110

  Fly   273 SVDAVVYYR--VSNATVSIANVENAHHSTRL--LAQTTLRNTMGTRHLHEILSERMTISGTMQVQ 333
            ::...|..|  .||..:....:...:....|  :....|::.:...:..:::::|..:|..::.:
Zfish   111 NIALRVLSRPLASNLPIMYQQLGQDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRE 175

  Fly   334 LDEATDAWGIKVERVEIKDVRL--------------PVQLQRAMAAEAEAAREARAKVIAAEGEQ 384
            |.|....:.|.::.|.|.::..              ..:.|||.....:|.:|.:.|:|.||||.
Zfish   176 LFERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFFVEKAKQEQKQKIIQAEGEA 240

  Fly   385 KASRALREASEVIGDSPAALQLRYLQT----LNTISAEKN 420
            :|::.|.||   :..:|..|:||.::.    ..|::|.:|
Zfish   241 QAAKMLGEA---VTKNPGYLKLRRIRAAQNIAKTVAASQN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 54/235 (23%)
SPFH_stomatin 229..430 CDD:259801 47/218 (22%)
phb2bNP_001002681.2 SPFH_prohibitin 49..243 CDD:259799 43/196 (22%)
PHB 49..209 CDD:214581 32/162 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.