DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and CG14736

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster


Alignment Length:302 Identity:131/302 - (43%)
Similarity:203/302 - (67%) Gaps:15/302 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 QQSQQQQAIHRAEARRDTQAKHSHG--------FLYSDEEISDKASTCGKLLIFLSVALVIMTLP 203
            :.|:..|.|...|.:|.:    :.|        ::.:.|:  :|.||..|:.|.:...|||:|.|
  Fly    15 EMSKHDQKIPPKEFKRPS----ADGGPRPPPSRYIQTSED--NKDSTFEKVAIGICWFLVIITFP 73

  Fly   204 FSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKD 268
            ||:..|..:|.||.|.:|.|||||.: |.:|||:.|||||||...|||:||...:|.||:|||||
  Fly    74 FSMCCCLTIVPEYSRMIILRLGRLRK-GLRGPGLVFILPCIDETHRVDMRTDVTNVRPQDVLTKD 137

  Fly   269 SVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQ 333
            |||::|:|||||.:.:...||..|::|..:|:|::|.||||.:|::.|:.:|:.|..:|..:|..
  Fly   138 SVTITVNAVVYYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQA 202

  Fly   334 LDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIG 398
            :...|..||::||||::.|:.||..|:|::|:||||.||||||:|.||||.|||:||:|||:|:.
  Fly   203 VAGITYRWGVRVERVDVMDITLPTSLERSLASEAEAVREARAKIILAEGELKASKALKEASDVMS 267

  Fly   399 DSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLITYFLKTNE 440
            ::...||||:||.|::|::|:...|::|:|::::..|:...|
  Fly   268 ENKITLQLRHLQILSSIASERRVRIIYPIPLEIMEPFMSGKE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 120/251 (48%)
SPFH_stomatin 229..430 CDD:259801 99/200 (50%)
CG14736NP_001287293.1 PHB 78..225 CDD:214581 69/147 (47%)
SPFH_like 100..305 CDD:302763 99/204 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473035
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.