DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and stoml3

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_989344.1 Gene:stoml3 / 394970 XenbaseID:XB-GENE-1015871 Length:283 Species:Xenopus tropicalis


Alignment Length:266 Identity:162/266 - (60%)
Similarity:208/266 - (78%) Gaps:4/266 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 SDEEISDKA----STCGKLLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGP 235
            |.||:.:.|    ..||.:::.||..:..:|.|.|::.|.|::|||||||:|||||::.|.||||
 Frog    15 SREELIEAADGNIGVCGWIILILSAFMAAITFPLSIWFCVKIIQEYERAVVFRLGRIISGKAKGP 79

  Fly   236 GIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTR 300
            |:.|:|||.|::.:||||..::.:||||:|||||||.:||.||||.:.:|..::|||.|.|.:|:
 Frog    80 GVMFVLPCTDTFIKVDLRVISFAIPPQEILTKDSVTTTVDGVVYYNIQSAIKAVANVNNVHIATQ 144

  Fly   301 LLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAA 365
            .||||||||.:||:.|..||:.|..|:..:|..||.||..||:||:|||::|||||||:||||||
 Frog   145 QLAQTTLRNILGTQTLANILANREEIAHNIQSILDHATHKWGVKVDRVEMRDVRLPVQMQRAMAA 209

  Fly   366 EAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPID 430
            ||||||||||||:|||||..|||||:|||.||.:||||||||||||||||:||.||||||||||:
 Frog   210 EAEAAREARAKVVAAEGEMNASRALKEASLVIAESPAALQLRYLQTLNTIAAENNSTIVFPLPIE 274

  Fly   431 LITYFL 436
            |:..||
 Frog   275 LMQGFL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 156/249 (63%)
SPFH_stomatin 229..430 CDD:259801 133/200 (67%)
stoml3NP_989344.1 SPFH_like 73..274 CDD:418525 133/200 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.