DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and stoml2

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_957325.1 Gene:stoml2 / 394006 ZFINID:ZDB-GENE-040426-1139 Length:355 Species:Danio rerio


Alignment Length:278 Identity:78/278 - (28%)
Similarity:136/278 - (48%) Gaps:59/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 TLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARV-DLRTRTYDVPPQEV 264
            :||.:..|.|  |.:.|..|:.|:||..:  ...||:.|::|.:|....| .|:....|||.|..
Zfish    36 SLPMNTVVLF--VPQQEAWVVERMGRFHR--ILEPGLNFLIPILDRIRYVQSLKEIVIDVPEQSA 96

  Fly   265 LTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGT 329
            ::.|:||:.:|.|:|.|:.:...:...||:..::...|||||:|:.:|...|.::..||.:::..
Zfish    97 VSLDNVTLQIDGVLYLRILDPFKASYGVEDPEYAVTQLAQTTMRSELGKLTLDKVFRERESLNSN 161

  Fly   330 MQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREAR-------------------- 374
            :...:::|:|.|||:..|.||||:.:|.:::.:|..:.||.|..|                    
Zfish   162 IVHSINQASDEWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESGGTRESAINVAEGR 226

  Fly   375 --AKVIAAEGE--QKASRALREASEVIGDSPA-ALQLRYLQTLNTISAEKNSTIVFPLPIDLITY 434
              |:::|:|||  ::.::|..||:.|:..:.| |..:|.|                         
Zfish   227 KQAQILASEGEKAEQINKAAGEANAVLAKAEAKAKAIRLL------------------------- 266

  Fly   435 FLKTNEATTQQNARAAAA 452
                :||.||||..|||:
Zfish   267 ----SEALTQQNGNAAAS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 69/264 (26%)
SPFH_stomatin 229..430 CDD:259801 59/226 (26%)
stoml2NP_957325.1 PHB 45..199 CDD:214581 49/157 (31%)
SPFH_paraslipin 79..189 CDD:259811 35/109 (32%)
Band_7_C 264..326 CDD:292817 11/46 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.