DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and Stoml2

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster


Alignment Length:306 Identity:80/306 - (26%)
Similarity:143/306 - (46%) Gaps:61/306 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 VCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARV-DLRTRTYDVPPQEVLTKDSVT 271
            :|...|.:.|..|:.|:||..:  ...||:..::|..|....| .|:....|||.|..:|.|:||
  Fly    41 MCVMFVPQQEAWVVERMGRFHR--ILDPGLNILVPVADKIKYVQSLKEIAIDVPKQSAITSDNVT 103

  Fly   272 VSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDE 336
            :|:|.|:|.|:.:...:...||:...:...|||||:|:.:|...:.::..||.:::.::...:::
  Fly   104 LSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSINK 168

  Fly   337 ATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKA--------------- 386
            |::||||...|.||:|:|||.::..||..:.||.|..||.::.:||.::|               
  Fly   169 ASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGKRKSRILA 233

  Fly   387 ---------SRALREASEVIGDSPA--------ALQLRYLQTLNTIS--------------AEKN 420
                     ::|..||:.:|..:.|        |..|.:|...|..|              |:.|
  Fly   234 SEAERQEHINKASGEAAAIIAVADARARSLLAIAKSLSHLDGQNAASLTLAEQYIGAFKKLAKTN 298

  Fly   421 STIVFPL-PID----------LITYFLKTNEAT-TQQNARAAAAAI 454
            :|::.|. |.|          :..:...:|:|| :.:|.:...|.:
  Fly   299 NTMILPSNPGDVNGFVAQALAVYNHVSNSNQATKSSENVKGVGACL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 75/289 (26%)
SPFH_stomatin 229..430 CDD:259801 67/248 (27%)
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 51/159 (32%)
SPFH_paraslipin 80..188 CDD:259811 36/107 (34%)
Band_7_C 266..326 CDD:292817 11/59 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473038
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.