DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and Stoml2

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001026816.1 Gene:Stoml2 / 298203 RGDID:1308285 Length:353 Species:Rattus norvegicus


Alignment Length:351 Identity:84/351 - (23%)
Similarity:155/351 - (44%) Gaps:76/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 AEARRDTQAKHSHGFLYSDEEISDKASTCGKLLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIF 222
            |.|.|.|.|....|.:.:...|..:||:               .||.:..:.|  |.:.|..|:.
  Rat     3 ARAARGTGALLLRGSVQASGRIPRRASS---------------GLPRNTVILF--VPQQEAWVVE 50

  Fly   223 RLGRLMQGGAKGPGIFFILPCIDSYARV-DLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNAT 286
            |:||..:  ...||:..::|.:|....| .|:....:||.|..:|.|:||:.:|.|:|.|:.:..
  Rat    51 RMGRFHR--ILEPGLNVLIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPY 113

  Fly   287 VSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIK 351
            .:...||:..::...|||||:|:.:|...|.::..||.:::..:...:::|.|.|||:..|.|||
  Rat   114 KASYGVEDPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNANIVDAINQAADCWGIRCLRYEIK 178

  Fly   352 DVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKA------------------------SRALRE 392
            |:.:|.:::.:|..:.||.|..||.|:.:||.:::                        ::|..|
  Rat   179 DIHVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQAAGE 243

  Fly   393 ASEVI---------------------GDSPAALQL--RYLQTLNTISAEKNSTIVFPLPIDLITY 434
            ||.|:                     ||:.|:|.:  :|:...:.::.:.|:.::...|.|:.:.
  Rat   244 ASAVLAKAKAKAEAIRILAGALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTVLLPSNPSDVTSM 308

  Fly   435 FLKTNEATTQQNARAAAAAIGNTPPP 460
            ..:         |.....|:...|.|
  Rat   309 VAQ---------AMGVYGALTKAPVP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 71/299 (24%)
SPFH_stomatin 229..430 CDD:259801 61/248 (25%)
Stoml2NP_001026816.1 HflC 38..314 CDD:223407 70/288 (24%)
SPFH_paraslipin 74..184 CDD:259811 35/109 (32%)
Band_7_C 259..321 CDD:292817 10/70 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..353 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.