DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and Stoml3

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001099901.1 Gene:Stoml3 / 295041 RGDID:1311090 Length:107 Species:Rattus norvegicus


Alignment Length:55 Identity:28/55 - (50%)
Similarity:41/55 - (74%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KASTCGKLLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPG 236
            :...||.:|.|||..|:::|.|.|:::|.|:::||||||:|||||:....|||||
  Rat    19 RLGVCGWILFFLSFLLMLITFPVSIWMCLKIIKEYERAVVFRLGRIQADKAKGPG 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 26/49 (53%)
SPFH_stomatin 229..430 CDD:259801 5/8 (63%)
Stoml3NP_001099901.1 SPFH_like 44..>73 CDD:302763 16/28 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354436
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45695
orthoMCL 1 0.900 - - OOG6_100539
Panther 1 1.100 - - O PTHR10264
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2327
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.