DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and Stoml3

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_694796.1 Gene:Stoml3 / 229277 MGIID:2388072 Length:287 Species:Mus musculus


Alignment Length:251 Identity:151/251 - (60%)
Similarity:201/251 - (80%) Gaps:0/251 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KASTCGKLLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDS 246
            :...||.:|.|||..|:::|.|.|:::|.|:::||||||:|||||:....|||||:..:|||||.
Mouse    19 RLGVCGWILFFLSFLLMLVTFPISVWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPCIDV 83

  Fly   247 YARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTM 311
            :.:|||||.|.::||||:||:||||..||.|||||:.:|..::|||.:.|.:|.|||||||||.:
Mouse    84 FVKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYRIYSAVSAVANVNDVHQATFLLAQTTLRNVL 148

  Fly   312 GTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAK 376
            ||:.|.:|||.|..|:.::|..||:||:.|||:|.||||||||:||||||:|||||||.||||||
Mouse   149 GTQTLSQILSGREEIAHSIQTLLDDATELWGIRVARVEIKDVRIPVQLQRSMAAEAEATREARAK 213

  Fly   377 VIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLI 432
            |:|||||..||::|:.||.|:.:||.||||||||||.|::.|||||||||||::::
Mouse   214 VLAAEGEMNASKSLKSASMVLAESPVALQLRYLQTLTTVATEKNSTIVFPLPMNIL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 149/245 (61%)
SPFH_stomatin 229..430 CDD:259801 128/200 (64%)
Stoml3NP_694796.1 PHB 45..200 CDD:214581 92/154 (60%)
SPFH_like 69..267 CDD:302763 128/197 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850730
Domainoid 1 1.000 69 1.000 Domainoid score I9581
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43620
orthoMCL 1 0.900 - - OOG6_100539
Panther 1 1.100 - - O PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.