DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and STOM

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_004090.4 Gene:STOM / 2040 HGNCID:3383 Length:288 Species:Homo sapiens


Alignment Length:281 Identity:183/281 - (65%)
Similarity:228/281 - (81%) Gaps:12/281 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 AEAR--RDTQAKHSHGFLYSDEEISDKAS----TCGKLLIFLSVALVIMTLPFSLFVCFKVVQEY 216
            ||.|  ||::|:.      ..:...|..|    .||.:|:..|....::|.|.|:::|.|:::||
Human     2 AEKRHTRDSEAQR------LPDSFKDSPSKGLGPCGWILVAFSFLFTVITFPISIWMCIKIIKEY 60

  Fly   217 ERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYR 281
            |||:||||||::||||||||:||||||.||:.:||:||.::|:||||:|||||||:|||.|||||
Human    61 ERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYR 125

  Fly   282 VSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVE 346
            |.|||:::||:.||..:|||||||||||.:||::|.:|||:|..|:..||..||:||||||||||
Human   126 VQNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDAWGIKVE 190

  Fly   347 RVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQT 411
            |||||||:|||||||||||||||:|||||||||||||..|||||:|||.||.:||||||||||||
Human   191 RVEIKDVKLPVQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQT 255

  Fly   412 LNTISAEKNSTIVFPLPIDLI 432
            |.||:||||||||||||||::
Human   256 LTTIAAEKNSTIVFPLPIDML 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 173/245 (71%)
SPFH_stomatin 229..430 CDD:259801 153/200 (77%)
STOMNP_004090.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 6/25 (24%)
SPFH_stomatin 73..274 CDD:259801 153/200 (77%)
Required for homooligomerization 265..273 7/7 (100%)
Required for lipid raft association 267..269 1/1 (100%)
Interaction with LANCL1. /evidence=ECO:0000269|PubMed:9512664 273..287 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160377
Domainoid 1 1.000 265 1.000 Domainoid score I1919
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H81681
Inparanoid 1 1.050 364 1.000 Inparanoid score I2173
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 1 1.000 - - otm41571
orthoMCL 1 0.900 - - OOG6_100539
Panther 1 1.100 - - LDO PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.760

Return to query results.
Submit another query.