DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and sto-3

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_509941.1 Gene:sto-3 / 191966 WormBaseID:WBGene00006065 Length:267 Species:Caenorhabditis elegans


Alignment Length:237 Identity:135/237 - (56%)
Similarity:175/237 - (73%) Gaps:0/237 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 ALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVP 260
            |.:::|.|.|:|.|.|:|:||:|.||||||||.|...:||||..:||.|||:..||||..:||||
 Worm    25 AFLLLTFPVSIFFCVKIVKEYDRMVIFRLGRLWQDNPRGPGIVLVLPFIDSHKTVDLRVMSYDVP 89

  Fly   261 PQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMT 325
            .||:||:||||:.|||.||||.|:...|:|.|.:||.|||.|||::|||.:|||.|.|::::|..
 Worm    90 TQEMLTRDSVTIGVDAAVYYRTSDPIASLARVNDAHMSTRQLAQSSLRNVLGTRSLAELMTDRHG 154

  Fly   326 ISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRAL 390
            |:..::..||.||..|||.||||||||:|||.::.|||||||||.||:.|||:.|:||..||.|.
 Worm   155 IAVQVKYILDSATLFWGIHVERVEIKDIRLPREMCRAMAAEAEAQRESDAKVVTAQGELDASMAF 219

  Fly   391 REASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLI 432
            ::|::.:..||.||||||||||..|||..|.|||.|.|::.|
 Worm   220 QKAADELAGSPTALQLRYLQTLVKISAHDNHTIVVPFPMEYI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 135/237 (57%)
SPFH_stomatin 229..430 CDD:259801 115/200 (58%)
sto-3NP_509941.1 PHB 37..196 CDD:214581 92/158 (58%)
SPFH_like 62..261 CDD:302763 114/198 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 1 1.100 - - O PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.