DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and Phb

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_032857.1 Gene:Phb / 18673 MGIID:97572 Length:272 Species:Mus musculus


Alignment Length:242 Identity:60/242 - (24%)
Similarity:107/242 - (44%) Gaps:36/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 RAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLT--KDSVTVSVDAVVYY 280
            |||||...|.:|....|.|..|::|.:......|.|:|..:||   |:|  ||...|::...:.:
Mouse    35 RAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVP---VITGSKDLQNVNITLRILF 96

  Fly   281 R-VSNATVSIANVENAHHSTRLLAQTT---LRNTMGTRHLHEILSERMTISGTMQVQLDEATDAW 341
            | |::....|.......:..|:|...|   |::.:......|::::|..:|..:...|.|....:
Mouse    97 RPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATF 161

  Fly   342 GIKVERVEI------KDVRLPVQLQRAMAAEAEAAR--------EARAKVIAAEGEQKASRALRE 392
            |:.::.|.:      |:....|:.::....|||.||        :.:|.:|:|||:.||:..:..
Mouse   162 GLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIAN 226

  Fly   393 ASEVIGDSPAALQLRYLQTLNTI----SAEKNST-------IVFPLP 428
            :....||  ..::||.|:....|    |..:|.|       ::..||
Mouse   227 SLATAGD--GLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 60/242 (25%)
SPFH_stomatin 229..430 CDD:259801 54/231 (23%)
PhbNP_032857.1 SPFH_prohibitin 27..221 CDD:259799 48/188 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.