DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and sto-1

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_509281.1 Gene:sto-1 / 181017 WormBaseID:WBGene00006063 Length:330 Species:Caenorhabditis elegans


Alignment Length:325 Identity:168/325 - (51%)
Similarity:221/325 - (68%) Gaps:29/325 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 QPQQQQQMQQPQQQLPHSHHALMQQSQQQQAIHRAEAR-RDTQAKHSHGFLYSDEEISDKASTCG 187
            ||.:..:||:           :.|.|.||:.:   ||| :...|.|||.            :.|.
 Worm     2 QPSETVEMQE-----------MAQPSGQQRDV---EARVQSAPANHSHD------------AGCT 40

  Fly   188 KLL-IFLSVALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVD 251
            ::. |.:|..|:.:|.|.|:|:|.|:||||:|||:||||||:. ..||||||||:||||::..:|
 Worm    41 EMFCIAMSYVLIFLTFPVSVFMCIKIVQEYQRAVVFRLGRLVP-DVKGPGIFFIIPCIDTFLNID 104

  Fly   252 LRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHL 316
            ||..:|:||.||:|::||||||||||||::|.:...|:..|.||..||:||||||||..:||..|
 Worm   105 LRVASYNVPSQEILSRDSVTVSVDAVVYFKVFDPITSVVGVGNATDSTKLLAQTTLRTILGTHTL 169

  Fly   317 HEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAE 381
            .||||:|..||..|::.|||||:.|||||||||::|||||.|:||||||||||.|:|.||:||||
 Worm   170 SEILSDREKISADMKISLDEATEPWGIKVERVELRDVRLPSQMQRAMAAEAEATRDAGAKIIAAE 234

  Fly   382 GEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLITYFLKTNEATTQQN 446
            ||.:||.||.||:.:|..|..|:|||||.|||.||:||.|||:||.|::::....|.....|.||
 Worm   235 GELRASAALAEAATIISKSEGAMQLRYLHTLNAISSEKTSTIIFPFPMEILGGISKVGSGGTSQN 299

  Fly   447  446
             Worm   300  299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 149/252 (59%)
SPFH_stomatin 229..430 CDD:259801 126/200 (63%)
sto-1NP_509281.1 PHB 62..220 CDD:214581 100/158 (63%)
SPFH_like 86..283 CDD:302763 126/196 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I6622
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.