DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and sto-2

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001257021.1 Gene:sto-2 / 180802 WormBaseID:WBGene00006064 Length:375 Species:Caenorhabditis elegans


Alignment Length:286 Identity:198/286 - (69%)
Similarity:233/286 - (81%) Gaps:13/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 EARRDTQA--------KHSHGFLYSDEEISDKASTCGKLLIFLSVALVIMTLPFSLFVCFKVVQE 215
            ||||.:.|        ||     .:.|........||..|:.||..:||.|.|.|::.|.|||||
 Worm    94 EARRQSLAQLKLSYYPKH-----MNPEHYDTGLGFCGWFLMGLSWIMVISTFPVSIYFCMKVVQE 153

  Fly   216 YERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYY 280
            ||||||||||||:.||||||||||:||||:||.:|||||.::.|||||:|||||||.|||||:||
 Worm   154 YERAVIFRLGRLIGGGAKGPGIFFVLPCIESYTKVDLRTVSFSVPPQEILTKDSVTTSVDAVIYY 218

  Fly   281 RVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKV 345
            |:||||||:||||||||||||||||||||.:|||.|.||||:|.|::.:||..|||||::|||||
 Worm   219 RISNATVSVANVENAHHSTRLLAQTTLRNMLGTRSLSEILSDRETLAASMQTILDEATESWGIKV 283

  Fly   346 ERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQ 410
            |||||||||||:||||||||||||.|||||||||||||||||||||:|:.||..|||||||||||
 Worm   284 ERVEIKDVRLPIQLQRAMAAEAEATREARAKVIAAEGEQKASRALRDAASVIAQSPAALQLRYLQ 348

  Fly   411 TLNTISAEKNSTIVFPLPIDLITYFL 436
            |||:::|||||||:||||::|:.:.:
 Worm   349 TLNSVAAEKNSTIIFPLPMELVRHLI 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 188/249 (76%)
SPFH_stomatin 229..430 CDD:259801 161/200 (81%)
sto-2NP_001257021.1 PHB 146..298 CDD:214581 119/151 (79%)
SPFH_like 168..368 CDD:302763 161/199 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167819
Domainoid 1 1.000 284 1.000 Domainoid score I864
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H81681
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 1 1.000 - - oto18778
orthoMCL 1 0.900 - - OOG6_100539
Panther 1 1.100 - - LDO PTHR10264
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2823
SonicParanoid 1 1.000 - - X2327
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.