DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and unc-24

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001355386.1 Gene:unc-24 / 177594 WormBaseID:WBGene00006761 Length:443 Species:Caenorhabditis elegans


Alignment Length:317 Identity:81/317 - (25%)
Similarity:149/317 - (47%) Gaps:60/317 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 ARRDTQAKHSHG-FLYSDE-----EISDKASTCGKLLIF-LSVALVIMTLPFSLFVCFKVVQEYE 217
            ||:.....:.:| |.|:.:     |...|..:..:|||| :|...|:||:|.||....|.:...|
 Worm    74 ARQGMMLGNKYGNFTYTRDYGVNMEDDIKPLSAIELLIFCVSFLFVVMTMPLSLLFALKFISTSE 138

  Fly   218 RAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRV 282
            :.|:.||||..:  .:||||..::||||:..:|.:....::|||.:::|.|...|.:.|.|:.::
 Worm   139 KLVVLRLGRAQK--TRGPGITLVIPCIDTTHKVTMSITAFNVPPLQIITTDRGLVELGATVFLKI 201

  Fly   283 SNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVER 347
            .:...::..|::.:.|.|     ||.|||    |:..:|::.....    :|...|..:|:::..
 Worm   202 RDPIAAVCGVQDRNASVR-----TLANTM----LYRYISKKRICDD----ELGSFTCQFGVEITD 253

  Fly   348 VEIKDVRLPVQLQR-AMAAEAEAAR---------------EARAKVIAAEGEQKASRALREASEV 396
            |||.||::..:.:. .|:|.:..|:               |..||..|||.:.|.:..|.:.|:|
 Worm   254 VEISDVKIVKEGENMGMSALSSVAKSDAGQQLWQVIGPVFEDFAKECAAEEKAKENAPLVDLSDV 318

  Fly   397 IGDSPA----------ALQLRYLQTLNTISAEK------------NSTIVFPLPIDL 431
            ...|.|          ::.:.:|.::.:::.::            |...:.|:.|||
 Worm   319 PSTSAAGTSTDTPNIPSIDIDHLISVASLAMDEHLVRLIGRVFQINCKDIEPICIDL 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 74/283 (26%)
SPFH_stomatin 229..430 CDD:259801 53/238 (22%)
unc-24NP_001355386.1 SPFH_like 146..263 CDD:388510 37/131 (28%)
SCP2 338..437 CDD:376720 6/38 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.