DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and phb-2

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_495250.2 Gene:phb-2 / 174034 WormBaseID:WBGene00004015 Length:294 Species:Caenorhabditis elegans


Alignment Length:251 Identity:58/251 - (23%)
Similarity:108/251 - (43%) Gaps:57/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 SLFVCFKVVQEYERAVIF-RLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVL--- 265
            |:|    .|:...||::| |:|.|.....| .|:.|.:|........|:|.|     |.::.   
 Worm    39 SMF----TVEAGHRAIMFNRIGGLSTDLYK-EGLHFRIPWFQYPIIYDIRAR-----PNQIRSPT 93

  Fly   266 -TKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQT------------TLRNTMGTRHLH 317
             :||...|::...|        :|..|.|:..|..|.|.|.            .|:..:...:..
 Worm    94 GSKDLQMVNIGLRV--------LSRPNPEHLVHIYRTLGQNWEERVLPSICNEVLKGVVAKFNAS 150

  Fly   318 EILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREA--------- 373
            :::::|..:|..::..|.|....:.|.::.|.:.::....|...|:.|:..||:||         
 Worm   151 QLITQRQQVSMLVRKTLIERALDFNIILDDVSLTELAFSPQYSAAVEAKQVAAQEAQRATFYVER 215

  Fly   374 -----RAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIV 424
                 :.|::.||||.::::.|.||.:   :.|..|:||.::     :|:|.:.||
 Worm   216 AKQQKQEKIVQAEGEAESAKLLGEAMK---NDPGFLKLRKIR-----AAQKIARIV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 58/251 (23%)
SPFH_stomatin 229..430 CDD:259801 49/226 (22%)
phb-2NP_495250.2 PHB 39..200 CDD:214581 38/178 (21%)
SPFH_prohibitin 40..234 CDD:259799 46/211 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.