DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and Nphs2

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_569723.1 Gene:Nphs2 / 170484 MGIID:2157018 Length:385 Species:Mus musculus


Alignment Length:248 Identity:129/248 - (52%)
Similarity:182/248 - (73%) Gaps:0/248 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 CGKLLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARV 250
            |..||:..|:..:|||.|||::.|.||||||||.:|||||.|:.|.|||||:||.|||:|:|.:|
Mouse   103 CEWLLVLASLIFIIMTFPFSIWFCIKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKV 167

  Fly   251 DLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRH 315
            |||.:|.::|..||:|||...:.:|||.|||:.||::.::::.:...:.:.|.|||::..:..|.
Mouse   168 DLRLQTLEIPFHEVVTKDMFIMEIDAVCYYRMENASLLLSSLAHVSKAIQFLVQTTMKRLLAHRS 232

  Fly   316 LHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAA 380
            |.|||.||.:|:..::|.||..|..|||||||.||||||||..||.::|.||||.|:|:.:||||
Mouse   233 LTEILLERKSIAQDVKVALDAVTCIWGIKVERTEIKDVRLPAGLQHSLAVEAEAQRQAKVRVIAA 297

  Fly   381 EGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLIT 433
            |||:.||.:||.|:|::..:|||:|||||.||.::|.||.:|:|.|||.|:::
Mouse   298 EGEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPATVVLPLPFDMLS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 128/246 (52%)
SPFH_stomatin 229..430 CDD:259801 103/200 (52%)
Nphs2NP_569723.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
SPFH_podocin 124..346 CDD:259809 117/221 (53%)
PHB 125..289 CDD:214581 85/163 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..385
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.