DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and STOML3

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_660329.1 Gene:STOML3 / 161003 HGNCID:19420 Length:291 Species:Homo sapiens


Alignment Length:268 Identity:155/268 - (57%)
Similarity:205/268 - (76%) Gaps:10/268 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 SDEEISDKAS----------TCGKLLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQ 229
            |..|..||.:          .||.:|..||..|||:|.|.|:::|.|:::||||||:|||||:..
Human     6 SSPEKQDKENFVGVNNKRLGVCGWILFSLSFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQA 70

  Fly   230 GGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVEN 294
            ..|||||:..:|||||.:.:|||||.|.::||||:||:||||..||.|||||:.:|..::|||.:
Human    71 DKAKGPGLILVLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYRIYSAVSAVANVND 135

  Fly   295 AHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQL 359
            .|.:|.|||||||||.:||:.|.:||:.|..|:.::|..||:||:.|||:|.||||||||:||||
Human   136 VHQATFLLAQTTLRNVLGTQTLSQILAGREEIAHSIQTLLDDATELWGIRVARVEIKDVRIPVQL 200

  Fly   360 QRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIV 424
            ||:|||||||.|||||||:|||||..||::|:.||.|:.:||.||||||||||:|::.|||||||
Human   201 QRSMAAEAEATREARAKVLAAEGEMNASKSLKSASMVLAESPIALQLRYLQTLSTVATEKNSTIV 265

  Fly   425 FPLPIDLI 432
            ||||::::
Human   266 FPLPMNIL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 149/245 (61%)
SPFH_stomatin 229..430 CDD:259801 127/200 (64%)
STOML3NP_660329.1 SPFH_like 73..271 CDD:327503 127/197 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160376
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 364 1.000 Inparanoid score I2173
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41571
orthoMCL 1 0.900 - - OOG6_100539
Panther 1 1.100 - - O PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.