DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42540 and Phb2

DIOPT Version :9

Sequence 1:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001013053.1 Gene:Phb2 / 114766 RGDID:620203 Length:299 Species:Rattus norvegicus


Alignment Length:258 Identity:55/258 - (21%)
Similarity:109/258 - (42%) Gaps:49/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 LLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIF-RLGRLMQGGAKGPGIFFILPCIDSYARVDL 252
            |.:.|....|...:..|:|    .|:...||:.| |:|.:.|......|:.|.:|........|:
  Rat    23 LKLLLGAGAVAYGVRESVF----TVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDI 83

  Fly   253 RTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAH------------HSTRLL--- 302
            |.|     |:::   .|.|.|.|    .::.|.::.:.:..||.            :..|:|   
  Rat    84 RAR-----PRKI---SSPTGSKD----LQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSI 136

  Fly   303 AQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRL------------ 355
            ....|::.:...:..:::::|..:|..::.:|.|....:.:.::.|.|.::..            
  Rat   137 VNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQ 201

  Fly   356 --PVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTIS 416
              ..:.|||.....:|.:|.|.|::.||||.:|::.|.||   :..:|..::||.::....||
  Rat   202 VAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEA---LSKNPGYIKLRKIRAAQNIS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42540NP_001246627.1 HflC 188..440 CDD:223407 55/258 (21%)
SPFH_stomatin 229..430 CDD:259801 44/217 (20%)
Phb2NP_001013053.1 Necessary for transcriptional repression. /evidence=ECO:0000250|UniProtKB:Q99623 19..49 6/29 (21%)
PHB 39..201 CDD:214581 32/177 (18%)
SPFH_prohibitin 40..235 CDD:259799 42/210 (20%)
Necessary for transcriptional repression. /evidence=ECO:0000250|UniProtKB:Q99623 150..174 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.