DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and B3GALT1

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_066191.1 Gene:B3GALT1 / 8708 HGNCID:916 Length:326 Species:Homo sapiens


Alignment Length:342 Identity:81/342 - (23%)
Similarity:146/342 - (42%) Gaps:75/342 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 IHQPSRTPSNSNDSSLVSNTFDNHPMGTPPTLASQTPTPPQSSMHLMDLPNFVYLIDQP-ACDKD 133
            |.:|:.:.:.|...|.::....|...|...|    .|..|.|         |.:||::| .|:|:
Human    25 ITRPTSSYTGSKPFSHLTVARKNFTFGNIRT----RPINPHS---------FEFLINEPNKCEKN 76

  Fly   134 VRAL-ILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGD 197
            :..| ||:.:..:..:.|:.|||||.:.:......:...||:|  ........|.:.:|:.:..|
Human    77 IPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLG--KNADPVLNQMVEQESQIFHD 139

  Fly   198 LIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRD 262
            :|..:|.|:|.|:|.|.:|.::|....|:.|:.::|.|.|:|:|...|:..|..||         
Human   140 IIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPS--------- 195

  Fly   263 PNLMLCRSVHHSRVKRSY--------------RSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVR 313
                       ::.:|.|              ||||.:....||:..||.:|.|...:::.:|..
Human   196 -----------TKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAE 249

  Fly   314 RLYEAAQKSKYFWVDDVLITGILAEETGSKITPLQ-----HYLEQKDV---RKLVGGEADLEDPP 370
            .:|:.:..::...::||.: |:...:.|  |.|.|     |:.....:   |:::          
Human   250 LIYKTSLHTRLLHLEDVYV-GLCLRKLG--IHPFQNSGFNHWKMAYSLCRYRRVI---------- 301

  Fly   371 FLFTNHAIKPDESMTIW 387
               |.|.|.|:|...||
Human   302 ---TVHQISPEEMHRIW 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 51/212 (24%)
B3GALT1NP_066191.1 Galactosyl_T 92..279 CDD:250845 51/211 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.