DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and B3GALNT1

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001336091.1 Gene:B3GALNT1 / 8706 HGNCID:918 Length:451 Species:Homo sapiens


Alignment Length:277 Identity:76/277 - (27%)
Similarity:124/277 - (44%) Gaps:55/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 LILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENH-LHGDLIQ 200
            :|||.|...:::.|:.||.||..:.......:..:||:|..:.|.:|.......:.| |:||:|:
Human   201 VILVTSHPSDVKARQAIRVTWGEKKSWWGYEVLTFFLLGQEAEKEDKMLALSLEDEHLLYGDIIR 265

  Fly   201 GNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLAT-----------PSL 254
            .:|.|.|.|:|.|.:||.:|..|.|.:|:.::|.|.|||:||..|||||..           |.:
Human   266 QDFLDTYNNLTLKTIMAFRWVTEFCPNAKYVMKTDTDVFINTGNLVKYLLNLNHSEKFFTGYPLI 330

  Fly   255 PEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAA 319
            ..||.                  |.:..|..::|:|||.:.:|.||.|:..:.:.::|.|:||..
Human   331 DNYSY------------------RGFYQKTHISYQEYPFKVFPPYCSGLGYIMSRDLVPRIYEMM 377

  Fly   320 QKSKYFWVDDVLITGI----------LAEETGSKITPLQHYLEQKDVRKLVGGEADLEDPPFLFT 374
            ...|....:||.: ||          :.|:|........| |:...:|:::..            
Human   378 GHVKPIKFEDVYV-GICLNLLKVNIHIPEDTNLFFLYRIH-LDVCQLRRVIAA------------ 428

  Fly   375 NHAIKPDESMTIWQMAL 391
             |.....|.:|.||:.|
Human   429 -HGFSSKEIITFWQVML 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 63/220 (29%)
B3GALNT1NP_001336091.1 Galactosyl_T 212..405 CDD:250845 61/211 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.