DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and AT1G53290

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_175736.2 Gene:AT1G53290 / 841763 AraportID:AT1G53290 Length:345 Species:Arabidopsis thaliana


Alignment Length:257 Identity:61/257 - (23%)
Similarity:102/257 - (39%) Gaps:61/257 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 TPTPPQSSMHLMDLP-NFVYLIDQPACDKDVRALILVHSAVRNIEKRRIIRETW------ANRSY 162
            |.|||::...:.|:. |...::........|...:.:.:...:..:||.:|:||      ..|..
plant    56 TNTPPKTVRVVWDVAGNSNGVVSGEKKRHKVMGFVGIQTGFGSAGRRRSLRKTWMPSDPEGLRRL 120

  Fly   163 IDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAH 227
            .:.|.|.:.|::|  ..|||:....|.||...:.|.:..:.::.|..:.||   .|.:|  |.|:
plant   121 EESTGLAIRFMIG--KTKSEEKMAQLRREIAEYDDFVLLDIEEEYSKLPYK---TLAFF--KAAY 178

  Fly   228 A----QLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSR----------VKR 278
            |    :..||.|||:::...:|                  :|:|.:...||:          |..
plant   179 ALYDSEFYVKADDDIYLRPDRL------------------SLLLAKERSHSQTYLGCLKKGPVFT 225

  Fly   279 SYRSKW-----RVTYKEYPNRFYPEYCPGMAIVYA--PEVVRRLYEAAQKS-KYFWVDDVLI 332
            ..:.||     .:..|||   |...|.|    :||  .:||..|......| :.|..:||.|
plant   226 DPKLKWYEPLSHLLGKEY---FLHAYGP----IYALSADVVASLVALKNNSFRMFNNEDVTI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 54/213 (25%)
AT1G53290NP_175736.2 Galactosyl_T 101..293 CDD:419759 54/212 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.