DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and AT1G33430

DIOPT Version :10

Sequence 1:NP_647916.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001185130.1 Gene:AT1G33430 / 840236 AraportID:AT1G33430 Length:403 Species:Arabidopsis thaliana


Alignment Length:38 Identity:9/38 - (23%)
Similarity:14/38 - (36%) Gaps:9/38 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 MENTTHDNISSLPRSDETEWNQHAVTNPDEVADEVLAL 58
            :||...|.::         :.:||........|.|.||
plant    63 LENVIRDAVT---------YTEHARRKTVTAMDVVYAL 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_647916.1 Galactosyl_T 148..347 CDD:473923
AT1G33430NP_001185130.1 PLN03193 7..401 CDD:178735 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.