DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and AT1G33430

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001185130.1 Gene:AT1G33430 / 840236 AraportID:AT1G33430 Length:403 Species:Arabidopsis thaliana


Alignment Length:372 Identity:72/372 - (19%)
Similarity:116/372 - (31%) Gaps:158/372 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 PQSSMHLMDLPNFVYLIDQPACDKDVRALI------------LVHSAVRNIEK------------ 149
            |:...|.:......:|..|..||:..|.||            ..|.||:::|:            
plant    36 PEEEDHHLTKHLSKHLEIQKDCDEHKRKLIESKSRDIIGEVSRTHQAVKSLERTMSTLEMELAAA 100

  Fly   150 RRIIR--ETWANRSYIDQTPLKVYFLVGGV----SAKSEK------W------------------ 184
            |...|  |.|:.||..:|:.|:..|.|.|:    |:|..:      |                  
plant   101 RTSDRSSEFWSERSAKNQSRLQKVFAVIGINTAFSSKKRRDSVRQTWMPTGEKLKKIEKEKGIVV 165

  Fly   185 ----------------------QQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCA- 226
                                  .:.:..|:..|.|.::....:.|..::.|..:   :|:...| 
plant   166 RKFGFLFDRFVIGHSATPGGVLDKAIDEEDSEHKDFLRLKHIEGYHQLSTKTRL---YFSTATAM 227

  Fly   227 -HAQLLVKVDDDVFMNTPQLV----KYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRV 286
             .|:..|||||||.:|...||    :|.:.|.:....|...|.|                |:..|
plant   228 YDAEFYVKVDDDVHVNLGMLVTTLARYQSRPRIYIGCMKSGPVL----------------SQKGV 276

  Fly   287 TYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQK-SKYFWVDDVLITGILAEETGSKITPLQHY 350
            .|.|      ||:                ::..:: :|||           ...||      |.|
plant   277 KYHE------PEF----------------WKFGEEGNKYF-----------RHATG------QIY 302

  Fly   351 LEQKDVRKLVGGEADLEDPPFLFTNHAI-----KPDESMTIWQMALD 392
            ...||:            ..::.||..|     ..|.|:..|.:.|:
plant   303 AISKDL------------ATYISTNQGILHRYANEDVSLGAWMLGLE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 49/269 (18%)
AT1G33430NP_001185130.1 PLN03193 7..401 CDD:178735 72/372 (19%)
DUF4094 7..103 CDD:290073 14/66 (21%)
Galactosyl_T 138..342 CDD:304462 46/270 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.