DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and B3GNT5

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_114436.1 Gene:B3GNT5 / 84002 HGNCID:15684 Length:378 Species:Homo sapiens


Alignment Length:294 Identity:89/294 - (30%)
Similarity:146/294 - (49%) Gaps:30/294 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SSMHLMDLPNFVYLID-QPACD-KDVRALILVHSAVRNIEKRRIIRETWANRSYID---QTPLKV 170
            |..|....|.:.|||: :..|. :||..|:.|.:|..|.::|..||.||.|.:|:.   ...:|.
Human    63 SLKHTSAGPRYQYLINHKEKCQAQDVLLLLFVKTAPENYDRRSGIRRTWGNENYVRSQLNANIKT 127

  Fly   171 YFLVGGVS-AKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKV 234
            .|.:|..: .:.|:.|:.|..|:..:.|:||.:|.|::.|:|.|.:|...|.|..|.||:.|:..
Human   128 LFALGTPNPLEGEELQRKLAWEDQRYNDIIQQDFVDSFYNLTLKLLMQFSWANTYCPHAKFLMTA 192

  Fly   235 DDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVK-RSYRSKWRVTYKEYPNRFYPE 298
            |||:|::.|.|::||  .||.:..:   .:..:.| ||..... |...||:.|:|:.|....||:
Human   193 DDDIFIHMPNLIEYL--QSLEQIGV---QDFWIGR-VHRGAPPIRDKSSKYYVSYEMYQWPAYPD 251

  Fly   299 YCPGMAIVYAPEVVRRLYEAAQK-SKYFWVDDVLITGILAEETGSKITPLQHYLEQKDVRKLVGG 362
            |..|.|.|.:.:|..::|||:|. :...::|||.: |:.|.:.|  |.|..|.        ...|
Human   252 YTAGAAYVISGDVAAKVYEASQTLNSSLYIDDVFM-GLCANKIG--IVPQDHV--------FFSG 305

  Fly   363 EADLEDPPFLF----TNHAIKPDESMTIWQMALD 392
            |......|.::    |:|. ..::...:|:.|.|
Human   306 EGKTPYHPCIYEKMMTSHG-HLEDLQDLWKNATD 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 66/204 (32%)
B3GNT5NP_114436.1 Galactosyl_T 102..299 CDD:389837 67/205 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.