DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and GALT1

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001319087.1 Gene:GALT1 / 839224 AraportID:AT1G26810 Length:643 Species:Arabidopsis thaliana


Alignment Length:294 Identity:74/294 - (25%)
Similarity:129/294 - (43%) Gaps:32/294 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LASQTPTPPQSSMHLMDLPNFVYLIDQPACD--KDVRALILVHSAVRNIEKRRIIRETWANRSYI 163
            |||..||..:|. |::||.    .:..|...  :.:..:|.|.|...|.::|..:|.||.....:
plant   362 LASGLPTSEESE-HVVDLE----ALKSPTLSPLRPLDLVIGVFSTANNFKRRMAVRRTWMQYDDV 421

  Fly   164 DQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHA 228
            ....:.|.|.||  ..||......|..|...:||:....|.|.|..:::| .:|:..|..:...|
plant   422 RSGRVAVRFFVG--LHKSPLVNLELWNEARTYGDVQLMPFVDYYSLISWK-TLAICIFGTEVDSA 483

  Fly   229 QLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVH-HSRVKRSYRSKWRVTYKEYP 292
            :.::|.|||.|:...:::..|        ||..:...::...:: .|:..|:..|||.::|:|:|
plant   484 KFIMKTDDDAFVRVDEVLLSL--------SMTNNTRGLIYGLINSDSQPIRNPDSKWYISYEEWP 540

  Fly   293 NRFYPEYCPGMAIVYAPEV---VRRLYEAAQKSKYFWVDDVLITGILAEETGSKITPLQHYLEQK 354
            ...||.:..|...:.:.::   |.:|::.. ..|.|.::||.:...:||.|...:.|  ||  :.
plant   541 EEKYPPWAHGPGYIVSRDIAESVGKLFKEG-NLKMFKLEDVAMGIWIAELTKHGLEP--HY--EN 600

  Fly   355 DVRKLVGGEADLEDPPFLFTNHAIKPDESMTIWQ 388
            |.|.:..|..|     .....|...|.|...:|:
plant   601 DGRIISDGCKD-----GYVVAHYQSPAEMTCLWR 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 49/202 (24%)
GALT1NP_001319087.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm1111
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.