DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and DD46

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_564154.1 Gene:DD46 / 838806 AraportID:AT1G22015 Length:398 Species:Arabidopsis thaliana


Alignment Length:305 Identity:59/305 - (19%)
Similarity:108/305 - (35%) Gaps:96/305 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LICINLCLVIWLVSVQQLPMLEAEIIADFSGSGGISSSSTAQPPTSAKSGLRRSRSQPNQI---- 70
            |:||: |..:..:...:|....::     |||..|               |:..|.|..:|    
plant    18 LLCIS-CFFLGAIFTSKLRSASSD-----SGSQLI---------------LQHRRDQELKIVTQD 61

  Fly    71 --HQPSRTPSNSNDSSLVSNTFDNH--------PMGTPPTLASQTPTPPQ-------SSMHLMDL 118
              |:..:    |.|:.::......|        .:.......|.|.:|.|       :|....:.
plant    62 YAHEKKK----SQDNDVMEEVLKTHKAIESLDKSVSMLQKQLSATHSPQQIVNVSATNSSTEGNQ 122

  Fly   119 PNFVYLIDQPACDKDVRALILVHSAVRNIEKRRIIRETWANR-----SYIDQTPLKVYFLVGGVS 178
            .|.|:::            |.:::|..:.::|..:||||..:     ....:..:.|.|::|..|
plant   123 KNKVFMV------------IGINTAFSSRKRRDSLRETWMPQGEKLEKLEKEKGIVVKFMIGHSS 175

  Fly   179 AKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCA--HAQLLVKVDDDVFMN 241
            ..:....:.:..|:..:.|..:.:..:.|.|::.|   ...:|:...|  .|:..||:||||.:|
plant   176 TPNSMLDKEIDSEDAQYNDFFRLDHVEGYYNLSAK---TKSFFSSAVAKWDAEFYVKIDDDVHVN 237

  Fly   242 TPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRV 286
            ...|...||                            |:|||.||
plant   238 LGTLASTLA----------------------------SHRSKPRV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 33/146 (23%)
DD46NP_564154.1 PLN03193 5..393 CDD:178735 59/305 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.