DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and AT5G62620

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_201068.1 Gene:AT5G62620 / 836383 AraportID:AT5G62620 Length:681 Species:Arabidopsis thaliana


Alignment Length:342 Identity:74/342 - (21%)
Similarity:133/342 - (38%) Gaps:76/342 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PSRTPSNSNDSS--LVSNTFDNHPM--GTPPTLASQTPTPPQSSMHLM------DLPNFVYLIDQ 127
            |.||.....|::  .::...|.|.:  |:.||  |.....||..:.|.      .||        
plant   374 PYRTGFTLEDATGLTINGDIDVHSVFAGSLPT--SHPSFSPQRHLELSSNWQAPSLP-------- 428

  Fly   128 PACDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGREN 192
               |:.|...|.:.||..:..:|..:|.:|.....:..:.:...|.|...|.|....:  |.:|.
plant   429 ---DEQVDMFIGILSAGNHFAERMAVRRSWMQHKLVKSSKVVARFFVALHSRKEVNVE--LKKEA 488

  Fly   193 HLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQ-LVKYLATPSLPE 256
            ...||::...:.|:|..:..|.|...::...:.| |:.::|.|||.|:.... |.:...||:   
plant   489 EFFGDIVIVPYMDSYDLVVLKTVAICEYGAHQLA-AKFIMKCDDDTFVQVDAVLSEAKKTPT--- 549

  Fly   257 YSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQK 321
                 |.:|.:....::.:..|  :.||.|||:|:|...||.|..|...:.:.::.|.:.:..:|
plant   550 -----DRSLYIGNINYYHKPLR--QGKWSVTYEEWPEEDYPPYANGPGYILSNDISRFIVKEFEK 607

  Fly   322 SK--YFWVDDVLITGILAEETGSKITP--------------LQHYLEQKDVRKLVGGEADLEDPP 370
            .|  .|.::||.: |:..|:..:...|              :::||                   
plant   608 HKLRMFKMEDVSV-GMWVEQFNNGTKPVDYIHSLRFCQFGCIENYL------------------- 652

  Fly   371 FLFTNHAIKPDESMTIW 387
               |.|...|.:.:.:|
plant   653 ---TAHYQSPRQMICLW 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 48/215 (22%)
AT5G62620NP_201068.1 PLN03133 126..681 CDD:215596 74/342 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm1111
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.