DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and AT4G32120

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_194939.1 Gene:AT4G32120 / 829344 AraportID:AT4G32120 Length:345 Species:Arabidopsis thaliana


Alignment Length:234 Identity:45/234 - (19%)
Similarity:96/234 - (41%) Gaps:21/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 QSSMHLMDLPNFVYLIDQPACD---KDVRALILVHSAVRNIEKRRIIRETWANR----SYIDQTP 167
            ::.|.|....:..||..|.:..   |.:.|:|.|::...:..||...|.:|..|    ..:::..
plant    91 ETEMELAQAKSQGYLKKQKSVSSSGKKMLAVIGVYTGFGSHLKRNKFRGSWMPRDDALKKLEERG 155

  Fly   168 LKVYFLVGGVSAKSEKWQQFLGRENHLHGD-LIQGNFKDAYRNMTYKHVMALKWFNEKCAH---A 228
            :.:.|::|..:.:.:...:.:..||....| ||..|.::|...:..|    :|:|......   |
plant   156 VVIRFVIGRSANRGDSLDRKIDEENRATKDFLILENHEEAQEELPKK----VKFFYSAAVQNWDA 216

  Fly   229 QLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPN 293
            :..|||||:|.::...::..|.:....:.:.:   ..|....|......:.|..:|   :|...:
plant   217 EFYVKVDDNVDLDLEGMIALLESRRSQDGAYI---GCMKSGDVITEEGSQWYEPEW---WKFGDD 275

  Fly   294 RFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLI 332
            :.|..:..|..::.:..:.:.:...:...|.:..||..|
plant   276 KSYFRHATGSLVILSKNLAQYVNINSGLLKTYAFDDTTI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 36/193 (19%)
AT4G32120NP_194939.1 DUF4094 24..102 CDD:290073 2/10 (20%)
Galactosyl_T 134..328 CDD:304462 35/191 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.