DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and AT3G14960

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_188114.1 Gene:AT3G14960 / 820725 AraportID:AT3G14960 Length:343 Species:Arabidopsis thaliana


Alignment Length:227 Identity:55/227 - (24%)
Similarity:88/227 - (38%) Gaps:60/227 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 VRALILVHSAVRNIEKRRIIRETW------ANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGREN 192
            |...:.:.:..|:..:||.:|.||      ..|...:.|.|.:.|::|  ..|.|.....|..|.
plant    84 VMGFVGIQTGFRSAGRRRALRNTWMPSDPEGLRRLEESTGLAIRFIIG--KTKDEAKMVELRSEV 146

  Fly   193 HLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHA----QLLVKVDDDVFMNTPQLVKYLATPS 253
            .::.|.|..:.::.|..:.||   .|.:|  |.|:|    :..||.|||:::...:|        
plant   147 AMYDDFILLDIEEEYSKLPYK---TLAFF--KAAYALYDSEFYVKADDDIYLRPDRL-------- 198

  Fly   254 LPEYSMLRDPNLMLCRSVHHSR----------VKRSYRSKW-----RVTYKEYPNRFYPEYCPGM 303
                      :|:|.:...||:          |....:.||     .:..|||   |...|.|  
plant   199 ----------SLLLAKERGHSQTYLGCMKKGPVFTDPKLKWYEPLADLLGKEY---FLHAYGP-- 248

  Fly   304 AIVYA--PEVVRRLYEAAQKS-KYFWVDDVLI 332
              :||  .:||..|......| :.|..:||.|
plant   249 --IYALSADVVTSLVALKNNSFRMFSNEDVTI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 53/213 (25%)
AT3G14960NP_188114.1 Galactosyl_T 99..293 CDD:304462 53/212 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.