DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and AT2G32430

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_180802.1 Gene:AT2G32430 / 817804 AraportID:AT2G32430 Length:409 Species:Arabidopsis thaliana


Alignment Length:179 Identity:38/179 - (21%)
Similarity:66/179 - (36%) Gaps:52/179 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 VHSAVRNIEKRRIIRETW-----ANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLI 199
            :::|..:.::|..:|.||     ..:...::..:.:.|::|..:.......:.:..|:..|||.:
plant   146 INTAFSSRKRRDSVRTTWMPSGEKRKKLEEEKGIIIRFVIGHSATAGGILDRSIEAEDKKHGDFL 210

  Fly   200 QGNFKDAY-----RNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSM 259
            :.:..:.|     :..||......||      .|:..|||||||.:|...|.:.|          
plant   211 RLDHVEGYLELSGKTKTYFSTAVSKW------DAEFYVKVDDDVHVNIATLGETL---------- 259

  Fly   260 LRDPNLMLCRSVHHSRVKRSY---------RSKWRVTYKEYPNRFYPEY 299
                       |.|.:..|.|         .|:..|.|.|      |||
plant   260 -----------VRHRKKHRVYLGCMKSGPVLSQKGVRYHE------PEY 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 37/171 (22%)
AT2G32430NP_180802.1 PLN03193 1..409 CDD:178735 38/179 (21%)
DUF4094 17..115 CDD:290073
Galactosyl_T 154..352 CDD:304462 37/171 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.