DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and AT2G26100

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_180179.2 Gene:AT2G26100 / 817150 AraportID:AT2G26100 Length:371 Species:Arabidopsis thaliana


Alignment Length:349 Identity:80/349 - (22%)
Similarity:124/349 - (35%) Gaps:117/349 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SSSSTAQPPTSAKSGLRRSRSQPNQIHQPSRTPSNSNDS---------SLVSNTFDNHPMGTPPT 100
            ||||.|.|....|..        ::.|:|:.:.|:...|         |||| .|    :|...|
plant    12 SSSSPASPSYYNKPS--------SKTHKPNSSSSSYTSSRIHVAIIFFSLVS-VF----IGVAGT 63

  Fly   101 LASQTPTPPQSSMHLMDLPNFVYLIDQPAC--DKDVRALILVHSAVRN-----------IEKRRI 152
            :.:.:.|.|.|          ||     .|  .||...::   ||.|.           :|:|::
plant    64 IFALSSTGPAS----------VY-----RCGGSKDTSRVV---SASRKLGGDGGNNGVVVERRKL 110

  Fly   153 ------------------IRETW-----ANRSYIDQ-TPLKVYFLVGGVSAKSEKWQQFLGRENH 193
                              :|.||     .:...::| |.|...|::|  .:|..|....|.:|..
plant   111 LGFVGIQTGFDSGDRRTALRSTWFPSDPDSLLRLEQATGLAFRFVIG--KSKDAKKMAELEKEIK 173

  Fly   194 LHGDLIQGNFKDAYRNMTYKHVMALKWFNE--KCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPE 256
            .:.|.:..:.::.|..:.||   .|.:|..  |...|...||.|||:::...:|...||...|..
plant   174 EYRDFVLLDTEEEYIRLPYK---TLAFFKAAFKLFEADYYVKADDDIYLRPDRLATLLANERLHS 235

  Fly   257 YS---------MLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEY---CPGMAIVYAP 309
            .:         ::.||.|                 ||   |::..|....||   ..|...|.:.
plant   236 QTYIGCMKKGPVITDPKL-----------------KW---YEKQGNLIGNEYFLHAYGPIYVLSA 280

  Fly   310 EVVRRLYEAAQKS-KYFWVDDVLI 332
            |:|..|..|...| :.|..:||.|
plant   281 EIVASLAAARNGSLRMFNNEDVTI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 51/224 (23%)
AT2G26100NP_180179.2 Galactosyl_T 124..319 CDD:250845 49/206 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.