DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and b3galt11

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001122268.1 Gene:b3galt11 / 798206 ZFINID:ZDB-GENE-030131-4878 Length:362 Species:Danio rerio


Alignment Length:294 Identity:74/294 - (25%)
Similarity:132/294 - (44%) Gaps:44/294 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SGLRRSRSQPNQIHQPSRTPSNSNDSSLVSNTFDNHPMGTPPTLASQTPTPPQSSMHLMDLPNFV 122
            :.::|...:||     :.:|:...|..|                           .|:....|:.
Zfish    63 ASVQREAQRPN-----ADSPNTEEDPGL---------------------------YHVAYPRNYK 95

  Fly   123 YLIDQPA-C-DKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEK-W 184
            ::|:||. | ::....:|:|.....:...|..||.|||....::...:.|.|::|..|...|: .
Zfish    96 FIINQPGICEERKPYVVIIVPVPPHDFNARNGIRNTWAGEKVVEGKEVLVLFILGLHSGDDEETL 160

  Fly   185 QQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYL 249
            |:.|..|:..:.||:|.||:|:|||:|.|.:|.::|.:..|..|...||||.||.:|...|:..|
Zfish   161 QEQLRNESQQYKDLLQSNFQDSYRNLTIKTMMMMEWLSRDCQQASYAVKVDADVLLNVNNLINML 225

  Fly   250 ATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRR 314
            .:.:..:      .|.|.......|.|.|...:|:.:.|..||...||.|..||..:.:.::.::
Zfish   226 VSLNTVQ------SNYMTGLVWDASPVIRDSSNKFFLPYDVYPKYAYPPYPLGMCYIISLDLPQK 284

  Fly   315 LYEAAQKSKYFWVDDVLITGILAEETGSKITPLQ 348
            ..:.::|.|..:::|..: |:..|..|  |.|::
Zfish   285 FLKESKKIKPLYIEDAYL-GMCLEHLG--IAPVK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 59/199 (30%)
b3galt11NP_001122268.1 Galactosyl_T 123..317 CDD:304462 60/202 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4688
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.