DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and si:dkeyp-98a7.1

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001138282.1 Gene:si:dkeyp-98a7.1 / 796449 ZFINID:ZDB-GENE-050208-519 Length:367 Species:Danio rerio


Alignment Length:283 Identity:88/283 - (31%)
Similarity:137/283 - (48%) Gaps:25/283 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 HLMDLPNFVYLIDQP-ACDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVG-G 176
            |:....|:.:::|:| .|.::...:::|..|...|:.|..||.||.|.:.:....:...|||| .
Zfish    96 HVAHPRNYDFMLDEPDVCKENPFLVLMVPVAPNQIDARNAIRSTWGNETTVQGKAVLTLFLVGLI 160

  Fly   177 VSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMN 241
            |.|.|||.||.|..|:..|.||||.||.|:|.|:|.|.::.:.|...:|..|...:|:|.|:|:|
Zfish   161 VGADSEKAQQQLEEESRQHRDLIQSNFVDSYFNLTIKTMVIMGWLATRCPQANYSMKIDSDMFLN 225

  Fly   242 TPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIV 306
            ...||..|:.|:.|.      .|.:....:.:..|.||..|||.|:.:.||...||.|..||..|
Zfish   226 VDNLVTLLSAPNTPR------ENYITGMVMWNRPVVRSKDSKWYVSEELYPEPTYPTYLLGMGYV 284

  Fly   307 YAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETG----SKITPLQH--YLEQKDVRKLVGGEAD 365
            ::.::..::.||::..|.|.::|..| |...:..|    |...|.|.  ||          |:..
Zfish   285 FSNDLPSKIVEASKYVKPFNIEDAYI-GACVKHLGYAPTSPPDPSQFRAYL----------GQYV 338

  Fly   366 LEDPPFLFTNHAIKPDESMTIWQ 388
            .||...:.|.....|.:.:.||:
Zfish   339 REDFFRVITTILGSPQQLIDIWK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 69/203 (34%)
si:dkeyp-98a7.1NP_001138282.1 Galactosyl_T 131..325 CDD:304462 69/200 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6075
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4688
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.