DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and b3gnt5b

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001093515.1 Gene:b3gnt5b / 791470 ZFINID:ZDB-GENE-041010-166 Length:401 Species:Danio rerio


Alignment Length:238 Identity:84/238 - (35%)
Similarity:127/238 - (53%) Gaps:16/238 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 NFVYLID-QPACD-KDVRALILVHSAVRNIEKRRIIRETWANRSYIDQT---PLKVYFLVG--GV 177
            |..|||: |..|| ||:..|:.|.|:..|.|:|:.||.||.|.::|:.|   .:||.|.:|  .:
Zfish    89 NHRYLINHQTTCDNKDILLLLFVKSSSENFERRQAIRSTWGNETFIENTLGVNVKVLFALGLHPI 153

  Fly   178 SAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNT 242
            ..:..|.::.|..|:..:.||||.:|.|.:.|:|.|.::.|.|....|.|||.|:..|||||::|
Zfish   154 PEERGKLKEDLMFEDQKYHDLIQQDFMDTFHNLTLKLLLQLGWKETYCHHAQFLMSADDDVFVHT 218

  Fly   243 PQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVY 307
            |.|:.|     |..:......:|.:.|....|...|...||:.|:...||...||:|.||...|.
Zfish   219 PNLILY-----LQGFGQSNTRDLWIGRVHRGSPPNRDKESKYYVSRDLYPWLSYPDYTPGSGYVL 278

  Fly   308 APEVVRRLYEAAQK-SKYFWVDDVLITGILAEETGSKITPLQH 349
            :.:||.|:|:|:.. :..|.:|||.: ||.|:.  ..::|..|
Zfish   279 SRDVVSRIYQASLTINASFHIDDVFL-GICAKM--MDVSPTDH 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 69/204 (34%)
b3gnt5bNP_001093515.1 Galactosyl_T 119..317 CDD:304462 70/205 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6075
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.