DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and si:dkey-160o24.3

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_021336785.1 Gene:si:dkey-160o24.3 / 558930 ZFINID:ZDB-GENE-140106-224 Length:459 Species:Danio rerio


Alignment Length:471 Identity:115/471 - (24%)
Similarity:183/471 - (38%) Gaps:138/471 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLCLLLICINLCLVIWLVSVQQLPMLEAEIIADFSGSGGISSSST--------AQPPTSAKSGLR 61
            |.|:||:.:  |:.:         |:....:.....:||.:...|        ..|......||:
Zfish    17 SPCILLLPV--CIYV---------MIAMSYVMKHGDTGGYAGPGTYVSTVSLPLLPDRFIARGLK 70

  Fly    62 RSRS-----------------------------QPNQIHQPSRTPSNSNDSSLVSNTFDNHPMGT 97
            |||.                             |.|.|..|:.|...|  |:|..:..:|   |.
Zfish    71 RSRDLAPHPEKSFWRSELESGALWNIIQYMMDRQRNPILSPNLTIETS--SNLERSKSEN---GC 130

  Fly    98 PP------------TLASQTPTPPQSSMHLMDLPNFVYLID-QPACDKDVRA-------LILVHS 142
            .|            ||    ||..::.:..|...::..:|| ...|:....|       |:.:.:
Zfish   131 SPNSNIDITMPDFLTL----PTQMKNFVRTMHCRDYAIIIDPSDVCNHGPLAKKWAPMLLLAIKT 191

  Fly   143 AVRNIEKRRIIRETWANRSYID--QTPLKV---YFLVGGVSAKSEKWQQFLGRENHLHGDLIQGN 202
            ...|.|.|..|||||.....|.  ...||:   .||:|  .:||.:.::.|..|:..:||::|..
Zfish   192 QTANFENREAIRETWGRSGRIKTRDGQLKIVRRVFLLG--KSKSRQHEEKLQLESKKYGDILQWE 254

  Fly   203 FKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYL----ATPSLPEYSMLRDP 263
            |.||:.|:|.|.|:..:||:.:|.||:.:.|.|||||:.||.::.||    |..||.:.|...: 
Zfish   255 FTDAFFNLTLKDVLFWEWFSRRCPHARFIFKGDDDVFVRTPAVLDYLQAVEANESLSDESKNME- 318

  Fly   264 NLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRF----YPEYCPGMAIVYAPEVVRRLYEAAQKSKY 324
            :.::...:|::...|:..:|:.:     |..|    ||.|..|..:||:..:..||.|.:|:...
Zfish   319 SFVIGDVIHNAAPIRTNNTKYFI-----PESFFKGLYPSYPGGGGVVYSGSLAHRLLEVSQRVHL 378

  Fly   325 FWVDDVLITGILAEETGSKITPLQHYLEQKDVRKLVGGEADLEDPPFL------------FTNHA 377
            |.:|||.: |:.....|  :.|:.|                   |.||            ..||.
Zfish   379 FPIDDVYL-GMCLRRLG--VYPVHH-------------------PAFLTFDFPKDEPKEPCANHT 421

  Fly   378 I------KPDESMTIW 387
            |      .|.|...:|
Zfish   422 ILLVHKRSPAEMFKLW 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 67/211 (32%)
si:dkey-160o24.3XP_021336785.1 Galactosyl_T 199..401 CDD:328824 68/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.